PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g36460.3.p
Common NameBRADI_4g36460, LOC100833219
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 240aa    MW: 27044.1 Da    PI: 8.7659
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g36460.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l  ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Bradi4g36460.3.p 14 KGAWTKEEDDRLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                      79******************************99************97 PP

2Myb_DNA-binding58.81.2e-1867111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++++eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Bradi4g36460.3.p  67 RGNFSEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.407961IPR017930Myb domain
SuperFamilySSF466892.47E-2913108IPR009057Homeodomain-like
SMARTSM007176.3E-131363IPR001005SANT/Myb domain
PfamPF002492.6E-141461IPR001005SANT/Myb domain
CDDcd001671.00E-91661No hitNo description
PROSITE profilePS5129428.96962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2865116IPR009057Homeodomain-like
SMARTSM007171.3E-1766114IPR001005SANT/Myb domain
PfamPF002496.2E-1767111IPR001005SANT/Myb domain
CDDcd001678.46E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLTAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLLSRG  120
IDPVSHRPTN EHVSNVTISF EAAREEKGSM FRLDEPKPAI GHDPVDWGQG KPLKCPDLNL  180
DLCISPPFQE DPMKPVKREA GVGVCFSCSL GLPRSSECKC SNFLGLRTAM LDFRSLEMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794101e-160HF679410.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB4 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578527.11e-177PREDICTED: myb-related protein Hv1
SwissprotP200261e-139MYB1_HORVU; Myb-related protein Hv1
TrEMBLI1ISA01e-177I1ISA0_BRADI; Uncharacterized protein
STRINGBRADI4G36460.11e-177(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-101myb domain protein 4